SCOPe 2.08: Domain d3v8wb1: 3v8w B:357-619

Lineage for d3v8wb1 (3v8w B:357-619)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Tyrosine-protein kinase Itk/Tsk [111194] (1 species)
   PTK group; Tec/Atk subfamily; non-membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [111195] (33 PDB entries)
   Uniprot Q08881 357-619

8. Domain d3v8wb1: 3v8w B:357-619 [195399]
   Other proteins in same PDB: d3v8wa2, d3v8wb2
   automated match to d1sm2a_
   complexed with 0g2, so4

Details for d3v8wb1

PDB Entry: 3v8w, 2.27 Å

PDB Description: crystal structure of interleukin-2 inducible t-cell kinase itk catalytic domain with thienopyrazolylindole inhibitor 469

PDB Compounds: (B:) Tyrosine-protein kinase ITK/TSK

SCOPe Domain Sequences for d3v8wb1:

Sequence, based on SEQRES records:

>d3v8wb1 d.144.1.7 (B:357-619) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
vidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmklshp
klvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleea
cvihrdlaarnclvgenqvikvsdfgmtrfvlddqytsstgtkfpvkwaspevfsfsrys
sksdvwsfgvlmwevfsegkipyenrsnsevvedistgfrlykprlasthvyqimnhcwk
erpedrpafsrllrqlaeiaesg

Sequence, based on observed residues (ATOM records):

>d3v8wb1 d.144.1.7 (B:357-619) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
vidpseltfvqeigsgglvhlgywlnkdkvaiktirmseedfieeaevmmklshpklvql
ygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleeacvihr
dlaarnclvgenqvikvsdfgpvkwaspevfsfsryssksdvwsfgvlmwevfsegkipy
enrsnsevvedistgfrlykprlasthvyqimnhcwkerpedrpafsrllrqlaeiaesg

Timeline for d3v8wb1:

• d3v8wb1 first appeared in SCOPe 2.02, called d3v8wb_
  
• d3v8wb1 appears in SCOPe 2.07