Lineage for d4aste_ (4ast E:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080913Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2081379Family c.1.7.0: automated matches [191491] (1 protein)
    not a true family
  6. 2081380Protein automated matches [190793] (26 species)
    not a true protein
  7. 2081418Species Escherichia coli K-12 [TaxId:83333] [226398] (2 PDB entries)
  8. 2081431Domain d4aste_: 4ast E: [195392]
    automated match to d3n6qd_

Details for d4aste_

PDB Entry: 4ast (more details), 2.38 Å

PDB Description: The apo structure of a bacterial aldo-keto reductase AKR14A1
PDB Compounds: (E:) aldo-keto reductase akr14a1

SCOPe Domain Sequences for d4aste_:

Sequence, based on SEQRES records: (download)

>d4aste_ c.1.7.0 (E:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
vwlanperygqmqyrycgksglrlpalslglwhnfghvnalesqrailrkafdlgithfd
lannygpppgsaeenfgrllredfaayrdeliistkagydmwpgpygsggsrkyllasld
qslkrmgleyvdifyshrvdentpmeetasalahavqsgkalyvgissyspertqkmvel
lrewkipllihqpsynllnrwvdksglldtlqnngvgciaftplaqglltgkylngipqd
srmhregnkvrgltpkmlteanlnslrllnemaqqrgqsmaqmalswllkddrvtsvlig
asraeqleenvqalnnltfstkelaqidqhiadg

Sequence, based on observed residues (ATOM records): (download)

>d4aste_ c.1.7.0 (E:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
vwlanperygqmqyrycgksglrlpalslglwhnfghvnalesqrailrkafdlgithfd
lannygpppgsaeenfgrllredfaayrdeliistkagydmwpgpygsggsrkyllasld
qslkrmgleyvdifyshrvdentpmeetasalahavqsgkalyvgissyspertqkmvel
lrewkipllihqpsynllnrwvdksglldtlqnngvgciaftplaqglltlteanlnslr
llnemaqqrgqsmaqmalswllkddrvtsvligasraeqleenvqalnnltfstkelaqi
dqhiadg

SCOPe Domain Coordinates for d4aste_:

Click to download the PDB-style file with coordinates for d4aste_.
(The format of our PDB-style files is described here.)

Timeline for d4aste_: