Lineage for d1b4wd_ (1b4w D:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 544466Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 544467Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 544472Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 544553Protein Snake phospholipase A2 [48624] (35 species)
  7. 544563Species Chinese water moccasin (Agkistrodon halys pallas), different isoforms [48628] (9 PDB entries)
  8. 544573Domain d1b4wd_: 1b4w D: [19539]

Details for d1b4wd_

PDB Entry: 1b4w (more details), 2.6 Å

PDB Description: basic phospholipase a2 from agkistrodon halys pallas-implications for its association and anticoagulant activities by x-ray crystallography

SCOP Domain Sequences for d1b4wd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b4wd_ a.133.1.2 (D:) Snake phospholipase A2 {Chinese water moccasin (Agkistrodon halys pallas), different isoforms}
hllqfrkmikkmtgkepvvsyafygcycgsggrgkpkdatdrccfvhdccyekvtgcdpk
wddytyswkngtivcggddpckkevcecdkaaaicfrdnlktykkrymaypdilcsskse
kc

SCOP Domain Coordinates for d1b4wd_:

Click to download the PDB-style file with coordinates for d1b4wd_.
(The format of our PDB-style files is described here.)

Timeline for d1b4wd_: