| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) ![]() alpha-beta(2)-alpha(2)-beta(3) |
| Family d.110.3.6: Flavin-binding PAS domain [88853] (4 proteins) contains PAC motif |
| Protein automated matches [190943] (2 species) not a true protein |
| Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188509] (20 PDB entries) |
| Domain d4eeua1: 4eeu A:388-494 [195381] Other proteins in same PDB: d4eeua2 automated match to d1jnua_ complexed with fmn |
PDB Entry: 4eeu (more details), 1.41 Å
SCOPe Domain Sequences for d4eeua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4eeua1 d.110.3.6 (A:388-494) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
eksfvitdprlpdypiifasdgflelteysreeimgrnarflqgpetdqatvqkirdair
dqrettvqlinytksgkkfwnllhlqpvrdrkgglqyfigvqlvgsd
Timeline for d4eeua1: