SCOPe 2.08: Domain d4eeua1: 4eeu A:388-494

Lineage for d4eeua1 (4eeu A:388-494)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.6: Flavin-binding PAS domain [88853] (4 proteins)
   contains PAC motif

6. Protein automated matches [190943] (2 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188509] (20 PDB entries)

8. Domain d4eeua1: 4eeu A:388-494 [195381]
   Other proteins in same PDB: d4eeua2
   automated match to d1jnua_
   complexed with fmn

Details for d4eeua1

PDB Entry: 4eeu, 1.41 Å

PDB Description: Crystal structure of phiLOV2.1

PDB Compounds: (A:) Phototropin-2

SCOPe Domain Sequences for d4eeua1:

Sequence; same for both SEQRES and ATOM records:

>d4eeua1 d.110.3.6 (A:388-494) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
eksfvitdprlpdypiifasdgflelteysreeimgrnarflqgpetdqatvqkirdair
dqrettvqlinytksgkkfwnllhlqpvrdrkgglqyfigvqlvgsd

Timeline for d4eeua1:

• d4eeua1 first appeared in SCOPe 2.02, called d4eeua_
  
• d4eeua1 appears in SCOPe 2.07