Lineage for d1b4wc_ (1b4w C:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 649171Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 649172Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 649177Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 649265Protein Snake phospholipase A2 [48624] (35 species)
  7. 649393Species Snake (Agkistrodon halys) [TaxId:8714] [48628] (9 PDB entries)
  8. 649402Domain d1b4wc_: 1b4w C: [19538]

Details for d1b4wc_

PDB Entry: 1b4w (more details), 2.6 Å

PDB Description: basic phospholipase a2 from agkistrodon halys pallas-implications for its association and anticoagulant activities by x-ray crystallography
PDB Compounds: (C:) protein (phospholipase a2)

SCOP Domain Sequences for d1b4wc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b4wc_ a.133.1.2 (C:) Snake phospholipase A2 {Snake (Agkistrodon halys) [TaxId: 8714]}
hllqfrkmikkmtgkepvvsyafygcycgsggrgkpkdatdrccfvhdccyekvtgcdpk
wddytyswkngtivcggddpckkevcecdkaaaicfrdnlktykkrymaypdilcsskse
kc

SCOP Domain Coordinates for d1b4wc_:

Click to download the PDB-style file with coordinates for d1b4wc_.
(The format of our PDB-style files is described here.)

Timeline for d1b4wc_: