Lineage for d4eera_ (4eer A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576610Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2576905Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2577060Family d.110.3.6: Flavin-binding PAS domain [88853] (4 proteins)
    contains PAC motif
  6. 2577079Protein automated matches [190943] (2 species)
    not a true protein
  7. 2577086Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188509] (20 PDB entries)
  8. 2577094Domain d4eera_: 4eer A: [195379]
    automated match to d1jnua_
    complexed with fmn; mutant

Details for d4eera_

PDB Entry: 4eer (more details), 1.75 Å

PDB Description: crystal structure of lov2 domain of arabidopsis thaliana phototropin 2 c426a mutant
PDB Compounds: (A:) Phototropin-2

SCOPe Domain Sequences for d4eera_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eera_ d.110.3.6 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
eknfvisdprlpdnpiifasdsflelteysreeilgrnarflqgpetdqatvqkirdair
dqreitvqlinytksgkkfwnlfhlqpmrdqkgelqyfigvqldgs

SCOPe Domain Coordinates for d4eera_:

Click to download the PDB-style file with coordinates for d4eera_.
(The format of our PDB-style files is described here.)

Timeline for d4eera_: