Lineage for d4exqa1 (4exq A:1-359)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089841Superfamily c.1.22: UROD/MetE-like [51726] (3 families) (S)
  5. 2089842Family c.1.22.1: Uroporphyrinogen decarboxylase, UROD [51727] (2 protein domains)
    automatically mapped to Pfam PF01208
  6. 2089868Protein automated matches [195370] (3 species)
    not a true protein
  7. 2089872Species Burkholderia thailandensis [TaxId:271848] [195371] (1 PDB entry)
  8. 2089873Domain d4exqa1: 4exq A:1-359 [195372]
    Other proteins in same PDB: d4exqa2
    automated match to d3cyva_
    complexed with na

Details for d4exqa1

PDB Entry: 4exq (more details), 1.65 Å

PDB Description: crystal structure of uroporphyrinogen decarboxylase (upd) from burkholderia thailandensis e264
PDB Compounds: (A:) Uroporphyrinogen decarboxylase

SCOPe Domain Sequences for d4exqa1:

Sequence, based on SEQRES records: (download)

>d4exqa1 c.1.22.1 (A:1-359) automated matches {Burkholderia thailandensis [TaxId: 271848]}
maqtlindtflrallreptdytpiwlmrqagrylpeynatraragsflglakhpdyatev
tlqplerfpldaailfsdiltipdamglgldfaagegpkfahpvrteadvaklavpdiga
tlgyvtdavreirraltdgegrqrvpligfsgspwtlacymvegggsddfrtvksmayar
pdlmhrildvnaqavaaylnaqieagaqavmifdtwggaladgayqrfsldyirrvvaql
krehdgarvpaiaftkggglwledlaatgvdavgldwtvnlgrarervagrvalqgnldp
tilfappeairaearavldsygnhpghvfnlghgisqftppehvaelvdevhrhsrair

Sequence, based on observed residues (ATOM records): (download)

>d4exqa1 c.1.22.1 (A:1-359) automated matches {Burkholderia thailandensis [TaxId: 271848]}
maqtlindtflrallreptdytpiwlmrqagrylpeynatraragsflglakhpdyatev
tlqplerfpldaailfsdiltipdamglgldfgpkfahpvrteadvaklavpdigatlgy
vtdavreirraltdgegrqrvpligfsgspwtlacymvegggsddfrtvksmayarpdlm
hrildvnaqavaaylnaqieagaqavmifdtwggaladgayqrfsldyirrvvaqlkreh
dgarvpaiaftkggglwledlaatgvdavgldwtvnlgrarervagrvalqgnldptilf
appeairaearavldsygnhpghvfnlghgisqftppehvaelvdevhrhsrair

SCOPe Domain Coordinates for d4exqa1:

Click to download the PDB-style file with coordinates for d4exqa1.
(The format of our PDB-style files is described here.)

Timeline for d4exqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4exqa2