![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
![]() | Protein automated matches [190140] (37 species) not a true protein |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [189278] (36 PDB entries) |
![]() | Domain d4f1ya_: 4f1y A: [195369] automated match to d3m3ka_ complexed with cni, zn |
PDB Entry: 4f1y (more details), 1.79 Å
SCOPe Domain Sequences for d4f1ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f1ya_ c.94.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} rtivvttilespyvmykknheqlegneryegycvdlayeiakhvrikyklsivgdgkyga rdpetkiwngmvgelvygradiavapltitlvreevidfskpfmslgisimikkgtpies aedlakqteiaygtldsgstkeffrrskiavyekmwsymksaepsvftkttadgvarvrk skgkfafllestmneyieqrkpcdtmkvggnldskgygvatpkgsalgnavnlavlklne qglldklknkwwydkgec
Timeline for d4f1ya_: