Lineage for d4f36e_ (4f36 E:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) 
Family d.58.6.0: automated matches [191597] (1 protein)
not a true familyProtein automated matches [191087] (10 species)
not a true protein
Species Trypanosoma brucei [TaxId:999953] [195043] (4 PDB entries) 
Domain d4f36e_: 4f36 E: [195365]
automated match to d3prvb_
complexed with scn
Details for d4f36e_
PDB Entry: 4f36 (more details), 2.3 Å
PDB Description: Crystal structure of Nucleoside diphosphate kinase B from Trypanosoma brucei, apo form
PDB Compounds: (E:) Nucleoside diphosphate kinaseSCOPe Domain Sequences for d4f36e_:
Sequence, based on SEQRES records: (download)
>d4f36e_ d.58.6.0 (E:) automated matches {Trypanosoma brucei [TaxId: 999953]}
smpsertfiavkpdgvqrnlvgeiikrfenkgyklvglkllqpteeqakqhyidlaskpf
ysglvsyfssgpivgmvweglgvvkggrvllgatnpadslpgtirgdfavdvgrnvchgs
dsvesakreiafwfkaeelvswtshsvkqiyera
Sequence, based on observed residues (ATOM records): (download)
>d4f36e_ d.58.6.0 (E:) automated matches {Trypanosoma brucei [TaxId: 999953]}
smpsertfiavkpdgvqrnlvgeiikrfenkgyklvglkllqpteeqakqhyfysglvsy
fssgpivgmvweglgvvkggrvllgatnpadslpgtirgdfavdvgrnvchgsdsvesak
reiafwfkaeelvswtshsvkqiyera
SCOPe Domain Coordinates for d4f36e_:
Click to download the PDB-style file with coordinates for d4f36e_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4f36e_:
- d4f36e_ first appeared in SCOPe 2.02
- d4f36e_ appears in SCOPe 2.04
- d4f36e_ is called d4f36e1 in SCOPe 2.06
- d4f36e_ appears in the current release, SCOPe 2.08, called d4f36e1
View in 3D
