Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.1: UBC-related [54496] (7 proteins) |
Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species) |
Species Human (Homo sapiens), E2 D3 [TaxId:9606] [143054] (3 PDB entries) Uniprot P61077 1-147 |
Domain d3ugba_: 3ugb A: [195361] Other proteins in same PDB: d3ugbb_ automated match to d1x23a1 complexed with gol |
PDB Entry: 3ugb (more details), 2.35 Å
SCOPe Domain Sequences for d3ugba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ugba_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 D3 [TaxId: 9606]} alkrinkelsdlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdyp fkppkvafttriyhpninsngsisldilrsqwspaltiskvllsicsllcdpnpddplvp eiariyktdrdkynrisrewtqkyam
Timeline for d3ugba_: