Lineage for d3vsaa_ (3vsa A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2907391Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2907392Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2907393Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 2907681Protein automated matches [190054] (13 species)
    not a true protein
  7. 2907682Species Aeropyrum pernix [TaxId:272557] [195353] (3 PDB entries)
  8. 2907683Domain d3vsaa_: 3vsa A: [195359]
    automated match to d1wkvb_
    complexed with mpd, plp

Details for d3vsaa_

PDB Entry: 3vsa (more details), 2.07 Å

PDB Description: crystal structure of o-phosphoserine sulfhydrylase without acetate
PDB Compounds: (A:) Protein CysO

SCOPe Domain Sequences for d3vsaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vsaa_ c.79.1.1 (A:) automated matches {Aeropyrum pernix [TaxId: 272557]}
aladisgyldvldsvrgfsylenarevlrsgearclgnprsepeyvkalyvigasripvg
dgcshtleelgvfdisvpgemvfpspldffergkptplvrsrlqlpngvrvwlklewynp
fslsvkdrpaveiisrlsrrvekgslvadatssnfgvalsavarlygyrarvylpgaaee
fgkllprllgaqvivdpeapstvhllprvmkdsknegfvhvnqfyndanfeahmrgtare
ifvqsrrgglalrgvagslgtsghmsaaafylqsvdpsiravlvqpaqgdsipgirrvet
gmlwinmldisytlaevtleeameavvevarsdglvigpsggaavkalakkaaegdlepg
dyvvvvpdtgfkylslvqnale

SCOPe Domain Coordinates for d3vsaa_:

Click to download the PDB-style file with coordinates for d3vsaa_.
(The format of our PDB-style files is described here.)

Timeline for d3vsaa_: