![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
![]() | Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) ![]() |
![]() | Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins) |
![]() | Protein automated matches [190054] (13 species) not a true protein |
![]() | Species Aeropyrum pernix [TaxId:272557] [195353] (3 PDB entries) |
![]() | Domain d3vsaa_: 3vsa A: [195359] automated match to d1wkvb_ complexed with mpd, plp |
PDB Entry: 3vsa (more details), 2.07 Å
SCOPe Domain Sequences for d3vsaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vsaa_ c.79.1.1 (A:) automated matches {Aeropyrum pernix [TaxId: 272557]} aladisgyldvldsvrgfsylenarevlrsgearclgnprsepeyvkalyvigasripvg dgcshtleelgvfdisvpgemvfpspldffergkptplvrsrlqlpngvrvwlklewynp fslsvkdrpaveiisrlsrrvekgslvadatssnfgvalsavarlygyrarvylpgaaee fgkllprllgaqvivdpeapstvhllprvmkdsknegfvhvnqfyndanfeahmrgtare ifvqsrrgglalrgvagslgtsghmsaaafylqsvdpsiravlvqpaqgdsipgirrvet gmlwinmldisytlaevtleeameavvevarsdglvigpsggaavkalakkaaegdlepg dyvvvvpdtgfkylslvqnale
Timeline for d3vsaa_: