Lineage for d3vsca_ (3vsc A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2139769Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2139770Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2139771Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 protein domains)
  6. 2140010Protein automated matches [190054] (13 species)
    not a true protein
  7. 2140011Species Aeropyrum pernix [TaxId:272557] [195353] (3 PDB entries)
  8. 2140014Domain d3vsca_: 3vsc A: [195356]
    automated match to d1wkvb_
    complexed with mpd, plp, sep; mutant

Details for d3vsca_

PDB Entry: 3vsc (more details), 2.07 Å

PDB Description: crystal structure of the k127a mutant of o-phosphoserine sulfhydrylase complexed with external schiff base of pyridoxal 5'-phosphate with o- phospho-l-serine
PDB Compounds: (A:) Protein CysO

SCOPe Domain Sequences for d3vsca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vsca_ c.79.1.1 (A:) automated matches {Aeropyrum pernix [TaxId: 272557]}
aladisgyldvldsvrgfsylenarevlrsgearclgnprsepeyvkalyvigasripvg
dgcshtleelgvfdisvpgemvfpspldffergkptplvrsrlqlpngvrvwlklewynp
fslsvadrpaveiisrlsrrvekgslvadatssnfgvalsavarlygyrarvylpgaaee
fgkllprllgaqvivdpeapstvhllprvmkdsknegfvhvnqfyndanfeahmrgtare
ifvqsrrgglalrgvagslgtsghmsaaafylqsvdpsiravlvqpaqgdsipgirrvet
gmlwinmldisytlaevtleeameavvevarsdglvigpsggaavkalakkaaegdlepg
dyvvvvpdtgfkylslvqnale

SCOPe Domain Coordinates for d3vsca_:

Click to download the PDB-style file with coordinates for d3vsca_.
(The format of our PDB-style files is described here.)

Timeline for d3vsca_: