SCOPe 2.05: Domain d3vsdb_: 3vsd B:

Lineage for d3vsdb_ (3vsd B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families)

5. Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)

6. Protein automated matches [190054] (10 species)
   not a true protein

7. Species Aeropyrum pernix [TaxId:272557] [195353] (3 PDB entries)

8. Domain d3vsdb_: 3vsd B: [195354]
   automated match to d1wkvb_
   complexed with mpd, oas, plp; mutant

Details for d3vsdb_

PDB Entry: 3vsd, 2.09 Å

PDB Description: crystal structure of the k127a mutant of o-phosphoserine sulfhydrylase complexed with external schiff base of pyridoxal 5'-phosphate with o- acetyl-l-serine

PDB Compounds: (B:) Protein CysO

SCOPe Domain Sequences for d3vsdb_:

Sequence; same for both SEQRES and ATOM records:

>d3vsdb_ c.79.1.1 (B:) automated matches {Aeropyrum pernix [TaxId: 272557]}
aladisgyldvldsvrgfsylenarevlrsgearclgnprsepeyvkalyvigasripvg
dgcshtleelgvfdisvpgemvfpspldffergkptplvrsrlqlpngvrvwlklewynp
fslsvadrpaveiisrlsrrvekgslvadatssnfgvalsavarlygyrarvylpgaaee
fgkllprllgaqvivdpeapstvhllprvmkdsknegfvhvnqfyndanfeahmrgtare
ifvqsrrgglalrgvagslgtsghmsaaafylqsvdpsiravlvqpaqgdsipgirrvet
gmlwinmldisytlaevtleeameavvevarsdglvigpsggaavkalakkaaegdlepg
dyvvvvpdtgfkylslvqnaleg

Timeline for d3vsdb_:

• d3vsdb_ first appeared in SCOPe 2.02
  
• d3vsdb_ appears in SCOPe 2.04
  
• d3vsdb_ appears in SCOPe 2.06
  
• d3vsdb_ appears in the current release, SCOPe 2.08