Lineage for d3vsdb_ (3vsd B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1182707Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 1182708Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 1182709Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 1182923Protein automated matches [190054] (8 species)
    not a true protein
  7. 1182924Species Aeropyrum pernix [TaxId:272557] [195353] (3 PDB entries)
  8. 1182930Domain d3vsdb_: 3vsd B: [195354]
    automated match to d1wkvb_
    complexed with mpd, oas, plp; mutant

Details for d3vsdb_

PDB Entry: 3vsd (more details), 2.09 Å

PDB Description: crystal structure of the k127a mutant of o-phosphoserine sulfhydrylase complexed with external schiff base of pyridoxal 5'-phosphate with o- acetyl-l-serine
PDB Compounds: (B:) Protein CysO

SCOPe Domain Sequences for d3vsdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vsdb_ c.79.1.1 (B:) automated matches {Aeropyrum pernix [TaxId: 272557]}
aladisgyldvldsvrgfsylenarevlrsgearclgnprsepeyvkalyvigasripvg
dgcshtleelgvfdisvpgemvfpspldffergkptplvrsrlqlpngvrvwlklewynp
fslsvadrpaveiisrlsrrvekgslvadatssnfgvalsavarlygyrarvylpgaaee
fgkllprllgaqvivdpeapstvhllprvmkdsknegfvhvnqfyndanfeahmrgtare
ifvqsrrgglalrgvagslgtsghmsaaafylqsvdpsiravlvqpaqgdsipgirrvet
gmlwinmldisytlaevtleeameavvevarsdglvigpsggaavkalakkaaegdlepg
dyvvvvpdtgfkylslvqnaleg

SCOPe Domain Coordinates for d3vsdb_:

Click to download the PDB-style file with coordinates for d3vsdb_.
(The format of our PDB-style files is described here.)

Timeline for d3vsdb_: