SCOP 1.73: Domain d1bjjf_: 1bjj F:

Lineage for d1bjjf_ (1bjj F:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)

6. Protein Snake phospholipase A2 [48624] (35 species)

7. Species Snake (Agkistrodon halys) [TaxId:8714] [48628] (9 PDB entries)

8. Domain d1bjjf_: 1bjj F: [19535]
   complexed with ca

Details for d1bjjf_

PDB Entry: 1bjj, 2.8 Å

PDB Description: agkistrodotoxin, a phospholipase a2-type presynaptic neurotoxin from agkistrodon halys pallas

PDB Compounds: (F:) agkistrodotoxin

SCOP Domain Sequences for d1bjjf_:

Sequence; same for both SEQRES and ATOM records:

>d1bjjf_ a.133.1.2 (F:) Snake phospholipase A2 {Snake (Agkistrodon halys) [TaxId: 8714]}
nllqfnkmikeetgknaipfyafygcycgwggqgkpkdgtdrccfvhdccygrlvncntk
sdiysyslkegyitcgkgtnceeqicecdrvaaecfrrnldtynngymfyrdskctetse
ec

Timeline for d1bjjf_:

• d1bjjf_ first appeared (with stable ids) in SCOP 1.55
  
• d1bjjf_ appears in SCOP 1.71
  
• d1bjjf_ appears in SCOP 1.75
  
• d1bjjf_ appears in the current release, SCOPe 2.08