Lineage for d4anma_ (4anm A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1929232Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1931583Protein automated matches [190091] (12 species)
    not a true protein
  7. 1932435Species Maize (Zea mays) [TaxId:4577] [195345] (1 PDB entry)
  8. 1932436Domain d4anma_: 4anm A: [195346]
    automated match to d1f0qa_
    complexed with wul

Details for d4anma_

PDB Entry: 4anm (more details), 1.7 Å

PDB Description: Complex of CK2 with a CDC7 inhibitor
PDB Compounds: (A:) Casein kinase II subunit alpha

SCOPe Domain Sequences for d4anma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4anma_ d.144.1.7 (A:) automated matches {Maize (Zea mays) [TaxId: 4577]}
sskarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekc
iikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvly
ptltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpg
keynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvki
akvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkll
rydhqerltaleamthpyfqqvraaens

SCOPe Domain Coordinates for d4anma_:

Click to download the PDB-style file with coordinates for d4anma_.
(The format of our PDB-style files is described here.)

Timeline for d4anma_: