SCOPe 2.02: Domain d4anma_: 4anm A:

Lineage for d4anma_ (4anm A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (10 species)
   not a true protein

7. Species Zea mays [TaxId:4577] [195345] (1 PDB entry)

8. Domain d4anma_: 4anm A: [195346]
   automated match to d1f0qa_
   complexed with wul

Details for d4anma_

PDB Entry: 4anm, 1.7 Å

PDB Description: Complex of CK2 with a CDC7 inhibitor

PDB Compounds: (A:) Casein kinase II subunit alpha

SCOPe Domain Sequences for d4anma_:

Sequence; same for both SEQRES and ATOM records:

>d4anma_ d.144.1.7 (A:) automated matches {Zea mays [TaxId: 4577]}
sskarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekc
iikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvly
ptltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpg
keynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvki
akvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkll
rydhqerltaleamthpyfqqvraaens

Timeline for d4anma_:

• d4anma_ is new in SCOPe 2.02-stable
  
• d4anma_ appears in SCOPe 2.03
  
• d4anma_ appears in the current release, SCOPe 2.08, called d4anma1