Lineage for d4anma1 (4anm A:7-333)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2545120Protein automated matches [190091] (19 species)
    not a true protein
  7. 2546086Species Maize (Zea mays) [TaxId:4577] [195345] (2 PDB entries)
  8. 2546087Domain d4anma1: 4anm A:7-333 [195346]
    Other proteins in same PDB: d4anma2
    automated match to d1f0qa_
    complexed with wul

Details for d4anma1

PDB Entry: 4anm (more details), 1.7 Å

PDB Description: Complex of CK2 with a CDC7 inhibitor
PDB Compounds: (A:) Casein kinase II subunit alpha

SCOPe Domain Sequences for d4anma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4anma1 d.144.1.7 (A:7-333) automated matches {Maize (Zea mays) [TaxId: 4577]}
skarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekci
ikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvlyp
tltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpgk
eynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvkia
kvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkllr
ydhqerltaleamthpyfqqvraaens

SCOPe Domain Coordinates for d4anma1:

Click to download the PDB-style file with coordinates for d4anma1.
(The format of our PDB-style files is described here.)

Timeline for d4anma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4anma2