SCOPe 2.08: Domain d3azca1: 3azc A:54-180

Lineage for d3azca1 (3azc A:54-180)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (4 families)

5. Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)

6. Protein automated matches [190874] (7 species)
   not a true protein

7. Species Thermosynechococcus elongatus [TaxId:197221] [195343] (1 PDB entry)

8. Domain d3azca1: 3azc A:54-180 [195344]
   Other proteins in same PDB: d3azca2
   automated match to d1q90c_
   complexed with fes

Details for d3azca1

PDB Entry: 3azc, 2 Å

PDB Description: Crystal structure of the soluble part of cytochrome b6f complex iron-sulfur subunit from Thermosynechococcus elongatus BP-1

PDB Compounds: (A:) Cytochrome b6-f complex iron-sulfur subunit

SCOPe Domain Sequences for d3azca1:

Sequence; same for both SEQRES and ATOM records:

>d3azca1 b.33.1.1 (A:54-180) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
avakdalgndikvseylakhlpgdrslaqgikgdptyvivtedhqianyglnavcthlgc
vvpwnvsenkficpchgsqydstgkvvrgpaplslalvkatvteddklvftpwteidfrt
gkepwwt

Timeline for d3azca1:

• d3azca1 first appeared in SCOPe 2.02, called d3azca_
  
• d3azca1 appears in SCOPe 2.07