SCOPe 2.05: Domain d3ay7b_: 3ay7 B:

Lineage for d3ay7b_ (3ay7 B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein automated matches [190085] (47 species)
   not a true protein

7. Species Bacillus megaterium [TaxId:1404] [195340] (5 PDB entries)

8. Domain d3ay7b_: 3ay7 B: [195342]
   automated match to d1gcoa_
   complexed with cl; mutant

Details for d3ay7b_

PDB Entry: 3ay7, 1.9 Å

PDB Description: Crystal structure of Bacillus megaterium glucose dehydrogenase 4 G259A mutant

PDB Compounds: (B:) Glucose 1-dehydrogenase 4

SCOPe Domain Sequences for d3ay7b_:

Sequence; same for both SEQRES and ATOM records:

>d3ay7b_ c.2.1.2 (B:) automated matches {Bacillus megaterium [TaxId: 1404]}
hmytdlkdkvvvitggstglgramavrfgqeeakvvinyynneeealdakkeveeaggqa
iivqgdvtkeedvvnlvqtaikefgtldvminnagvenpvpshelsldnwnkvidtnltg
aflgsreaikyfvendikgnvinmssvhemipwplfvhyaaskggmklmtetlaleyapk
girvnnigpgamntpinaekfadpvqradvesmipmgyigkpeevaavaaflassqasyv
tgitlfadggmtkypsfqa

Timeline for d3ay7b_:

• d3ay7b_ first appeared in SCOPe 2.02
  
• d3ay7b_ appears in SCOPe 2.04
  
• d3ay7b_ is called d3ay7b1 in SCOPe 2.06
  
• d3ay7b_ appears in the current release, SCOPe 2.08, called d3ay7b1