Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.6: Ubiquitin carboxyl-terminal hydrolase UCH-L [54050] (3 proteins) automatically mapped to Pfam PF01088 |
Protein Ubiquitin carboxyl-terminal hydrolase isozyme l1 [142856] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [142857] (4 PDB entries) Uniprot P09936 1-223 |
Domain d4dm9a_: 4dm9 A: [195339] automated match to d2etla1 |
PDB Entry: 4dm9 (more details), 2.35 Å
SCOPe Domain Sequences for d4dm9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dm9a_ d.3.1.6 (A:) Ubiquitin carboxyl-terminal hydrolase isozyme l1 {Human (Homo sapiens) [TaxId: 9606]} mqlkpmeinpemlnkvlsrlgvagqwrfvdvlgleeeslgsvpapacallllfpltaqhe nfrkkqieelkgqevspkvyfmkqtignscgtiglihavannqdklgfedgsvlkqflse tekmspedrakcfekneaiqaahdavaqegqcrvddkvnfhfilfnnvdghlyeldgrmp fpvnhgassedtllkdaakvcreftereqgevrfsavalckaa
Timeline for d4dm9a_: