Lineage for d1bjjd_ (1bjj D:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6695Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
  4. 6696Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (2 families) (S)
  5. 6701Family a.133.1.2: Vertebrate phospholipase A2 [48623] (4 proteins)
  6. 6765Protein Snake phospholipase A2 [48624] (12 species)
  7. 6769Species Chinese water moccasin (Agkistrodon halys pallas), different isoforms [48628] (6 PDB entries)
  8. 6777Domain d1bjjd_: 1bjj D: [19533]

Details for d1bjjd_

PDB Entry: 1bjj (more details), 2.8 Å

PDB Description: agkistrodotoxin, a phospholipase a2-type presynaptic neurotoxin from agkistrodon halys pallas

SCOP Domain Sequences for d1bjjd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bjjd_ a.133.1.2 (D:) Snake phospholipase A2 {Chinese water moccasin (Agkistrodon halys pallas), different isoforms}
nllqfnkmikeetgknaipfyafygcycgwggqgkpkdgtdrccfvhdccygrlvncntk
sdiysyslkegyitcgkgtnceeqicecdrvaaecfrrnldtynngymfyrdskctetse
ec

SCOP Domain Coordinates for d1bjjd_:

Click to download the PDB-style file with coordinates for d1bjjd_.
(The format of our PDB-style files is described here.)

Timeline for d1bjjd_: