SCOPe 2.02: Domain d4esea_: 4ese A:

Lineage for d4esea_ (4ese A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.3: Quinone reductase [52235] (4 proteins)
   binds FAD

6. Protein automated matches [190235] (2 species)
   not a true protein

7. Species Yersinia pestis [TaxId:214092] [195328] (1 PDB entry)

8. Domain d4esea_: 4ese A: [195329]
   automated match to d1tika_
   complexed with 12p, fmn, gol, imd

Details for d4esea_

PDB Entry: 4ese, 1.45 Å

PDB Description: The crystal structure of azoreductase from Yersinia pestis CO92 in complex with FMN.

PDB Compounds: (A:) FMN-dependent NADH-azoreductase

SCOPe Domain Sequences for d4esea_:

Sequence, based on SEQRES records:

>d4esea_ c.23.5.3 (A:) automated matches {Yersinia pestis [TaxId: 214092]}
amskvlvlkssilatssqsnqladffveqwqaahagdqitvrdlaaqpipvldgelvgal
rpsgtaltprqqealalsdeliaelqandviviaapmynfniptqlknyfdmiaragvtf
rytekgpeglvtgkraiiltsrggihkdtptdlvvpylrlflgfigitdvefvfaegiay
gpevatkaqadaktllaqvva

Sequence, based on observed residues (ATOM records):

>d4esea_ c.23.5.3 (A:) automated matches {Yersinia pestis [TaxId: 214092]}
amskvlvlkssilatssqsnqladffveqwqaahagdqitvrdlaaqpipvldgelvgal
rpsgtaltprqqealalsdeliaelqandviviaapmynfniptqlknyfdmiaragvtf
rytekgpeglvtgkraiiltsrgdlvvpylrlflgfigitdvefvfaegiaygpevatka
qadaktllaqvva

Timeline for d4esea_:

• d4esea_ is new in SCOPe 2.02-stable
  
• d4esea_ appears in SCOPe 2.03
  
• d4esea_ appears in the current release, SCOPe 2.08, called d4esea1