Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) |
Family c.23.5.3: Quinone reductase [52235] (4 proteins) binds FAD |
Protein automated matches [190235] (2 species) not a true protein |
Species Yersinia pestis [TaxId:214092] [195328] (1 PDB entry) |
Domain d4esea_: 4ese A: [195329] automated match to d1tika_ complexed with 12p, fmn, gol, imd |
PDB Entry: 4ese (more details), 1.45 Å
SCOPe Domain Sequences for d4esea_:
Sequence, based on SEQRES records: (download)
>d4esea_ c.23.5.3 (A:) automated matches {Yersinia pestis [TaxId: 214092]} amskvlvlkssilatssqsnqladffveqwqaahagdqitvrdlaaqpipvldgelvgal rpsgtaltprqqealalsdeliaelqandviviaapmynfniptqlknyfdmiaragvtf rytekgpeglvtgkraiiltsrggihkdtptdlvvpylrlflgfigitdvefvfaegiay gpevatkaqadaktllaqvva
>d4esea_ c.23.5.3 (A:) automated matches {Yersinia pestis [TaxId: 214092]} amskvlvlkssilatssqsnqladffveqwqaahagdqitvrdlaaqpipvldgelvgal rpsgtaltprqqealalsdeliaelqandviviaapmynfniptqlknyfdmiaragvtf rytekgpeglvtgkraiiltsrgdlvvpylrlflgfigitdvefvfaegiaygpevatka qadaktllaqvva
Timeline for d4esea_: