SCOPe 2.08: Domain d4esea1: 4ese A:1-200

Lineage for d4esea1 (4ese A:1-200)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.3: Quinone reductase [52235] (4 proteins)
   binds FAD

6. Protein automated matches [190235] (2 species)
   not a true protein

7. Species Yersinia pestis [TaxId:214092] [195328] (2 PDB entries)

8. Domain d4esea1: 4ese A:1-200 [195329]
   Other proteins in same PDB: d4esea2
   automated match to d1tika_
   complexed with 12p, fmn, gol, imd

Details for d4esea1

PDB Entry: 4ese, 1.45 Å

PDB Description: The crystal structure of azoreductase from Yersinia pestis CO92 in complex with FMN.

PDB Compounds: (A:) FMN-dependent NADH-azoreductase

SCOPe Domain Sequences for d4esea1:

Sequence, based on SEQRES records:

>d4esea1 c.23.5.3 (A:1-200) automated matches {Yersinia pestis [TaxId: 214092]}
mskvlvlkssilatssqsnqladffveqwqaahagdqitvrdlaaqpipvldgelvgalr
psgtaltprqqealalsdeliaelqandviviaapmynfniptqlknyfdmiaragvtfr
ytekgpeglvtgkraiiltsrggihkdtptdlvvpylrlflgfigitdvefvfaegiayg
pevatkaqadaktllaqvva

Sequence, based on observed residues (ATOM records):

>d4esea1 c.23.5.3 (A:1-200) automated matches {Yersinia pestis [TaxId: 214092]}
mskvlvlkssilatssqsnqladffveqwqaahagdqitvrdlaaqpipvldgelvgalr
psgtaltprqqealalsdeliaelqandviviaapmynfniptqlknyfdmiaragvtfr
ytekgpeglvtgkraiiltsrgdlvvpylrlflgfigitdvefvfaegiaygpevatkaq
adaktllaqvva

Timeline for d4esea1:

• d4esea1 first appeared in SCOPe 2.02, called d4esea_
  
• d4esea1 appears in SCOPe 2.07