Lineage for d4ex4a_ (4ex4 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088435Superfamily c.1.13: Malate synthase G [51645] (1 family) (S)
  5. 2088436Family c.1.13.1: Malate synthase G [51646] (2 protein domains)
  6. 2088450Protein automated matches [195320] (6 species)
    not a true protein
  7. 2088451Species Mycobacterium leprae [TaxId:561304] [195321] (1 PDB entry)
  8. 2088452Domain d4ex4a_: 4ex4 A: [195323]
    automated match to d1n8ia_
    complexed with edo, mg

Details for d4ex4a_

PDB Entry: 4ex4 (more details), 2.1 Å

PDB Description: The Structure of GlcB from Mycobacterium leprae
PDB Compounds: (A:) malate synthase g

SCOPe Domain Sequences for d4ex4a_:

Sequence, based on SEQRES records: (download)

>d4ex4a_ c.1.13.1 (A:) automated matches {Mycobacterium leprae [TaxId: 561304]}
drvsagnlrvarvlydfvnnealpgtdinpnsfwsgvakvvadltpqnqsllnsrdelqa
qidkwhrhrviepfdvdayrqflidigyllpepddftistsgvddeitmtagpqlvvpvl
narfalnaanarwgslydalygtdtipetegaekgseynkirgdkviayarkfmdqavpl
asdswtnatgvsifdgqlqiaigtnstglaspekfvgynrqlrssnwsvllanhglhiev
lidpespigktdpvgikdvilesaittimdfedsvtavdaddkvrgyrnwlglnkgdlte
evnkdgktftrvlnadrsyttpdggeltlpgrsllfvrnvghlttsdailvdggdgqeke
vfegiidavftglaaihglktgeangpltnsrtgsiyivkpkmhgpaevaftcelfsrve
dvlglpqgtlkvgimdeerrttlnlkacikaaadrvvfintgfldrtgdeihtsmeagpm
irkgamknstwikayedanvdiglaagfkgkaqigkgmwamtelmadmveqkigqpkaga
ttawvpsptaatlhamhyhqvdvaavqqeltgqrratvdqlltiplakklawapeeiree
vdndcqsilgyvvrwvdqgigcskvpdihnvalmedratlrissqllanwlrhgvitsed
vraslermaplvdqqnaedpayrpmapnfddsiaflaaqelilsgaqqpngytepilhrr
rrefkaq

Sequence, based on observed residues (ATOM records): (download)

>d4ex4a_ c.1.13.1 (A:) automated matches {Mycobacterium leprae [TaxId: 561304]}
drvsagnlrvarvlydfvnnealpgtdinpnsfwsgvakvvadltpqnqsllnsrdelqa
qidkwhrhrvifdvdayrqflidigyllpepddftistsgvddeitmtagpqlvvpvlna
rfalnaanarwgslydalygtdtipeteseynkirgdkviayarkfmdqavplasswtna
tgvsqlqiaaspekfvgynvllanhglhievlikdvilesaittimdfedsvtavdaddk
vrgyrnwlglnkgdlteevnkdgktftrvlnadrsyttpdggeltlpgrsllfvrnvghl
ttsdailvdggdgqekevfegiidavftglaaihglktgeangpltnsrtgsiyivkpkm
hgpaevaftcelfsrvedvlglpqgtlkvgimdeerrttlnlkacikaaadrvvfintgf
ldrtgdeihtsmeagpmirkgamknstwikayedanvdiglaagfkgkaqigkgmwamte
lmadmveqkigqpkagattawvpsptaatlhamhyhqvdvaavqqeltgqrratvdqllt
iplakklawapeeireevdndcqsilgyvvrwvdqgigcskvpdihnvalmedratlris
sqllanwlrhgvitsedvraslermaplvdqqnaedpayrpmapnfddsiaflaaqelil
sgaqqpngytepilhrrrrefkaq

SCOPe Domain Coordinates for d4ex4a_:

Click to download the PDB-style file with coordinates for d4ex4a_.
(The format of our PDB-style files is described here.)

Timeline for d4ex4a_: