Lineage for d1bjjc_ (1bjj C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733039Protein Snake phospholipase A2 [48624] (38 species)
  7. 2733099Species Halys viper (Agkistrodon halys) [TaxId:8714] [48628] (9 PDB entries)
  8. 2733108Domain d1bjjc_: 1bjj C: [19532]
    complexed with ca

Details for d1bjjc_

PDB Entry: 1bjj (more details), 2.8 Å

PDB Description: agkistrodotoxin, a phospholipase a2-type presynaptic neurotoxin from agkistrodon halys pallas
PDB Compounds: (C:) agkistrodotoxin

SCOPe Domain Sequences for d1bjjc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bjjc_ a.133.1.2 (C:) Snake phospholipase A2 {Halys viper (Agkistrodon halys) [TaxId: 8714]}
nllqfnkmikeetgknaipfyafygcycgwggqgkpkdgtdrccfvhdccygrlvncntk
sdiysyslkegyitcgkgtnceeqicecdrvaaecfrrnldtynngymfyrdskctetse
ec

SCOPe Domain Coordinates for d1bjjc_:

Click to download the PDB-style file with coordinates for d1bjjc_.
(The format of our PDB-style files is described here.)

Timeline for d1bjjc_: