![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.8: RhoGDI-like [81288] (3 proteins) |
![]() | Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (3 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [195317] (1 PDB entry) |
![]() | Domain d4f38b_: 4f38 B: [195318] Other proteins in same PDB: d4f38a_ automated match to d1doab_ complexed with ger, gnp, mg |
PDB Entry: 4f38 (more details), 2.8 Å
SCOPe Domain Sequences for d4f38b_:
Sequence, based on SEQRES records: (download)
>d4f38b_ b.1.18.8 (B:) Rho GDP-dissociation inhibitor 1, RhoGDI {Mouse (Mus musculus) [TaxId: 10090]} taeqlaqiaaeneedehsvnykppaqksiqeiqeldkddeslrkykeallgrvavsadpn vpnvvvtrltlvcstapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsgm kyiqhtyrkgvkidktdymvgsygpraeeyefltpmeeapkgmlargsyniksrftdddr tdhlswewnltikkewkd
>d4f38b_ b.1.18.8 (B:) Rho GDP-dissociation inhibitor 1, RhoGDI {Mouse (Mus musculus) [TaxId: 10090]} taeqlaqiaaenvnykppaqksiqeiqeldkddeslrkykeallgrvavsadpnvpnvvv trltlvcstapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsgmkyiqht yrkgvkidktdymvgsygpraeeyefltpmeeapkgmlargsyniksrftdddrtdhlsw ewnltikkewkd
Timeline for d4f38b_: