SCOPe 2.05: Domain d4f38b_: 4f38 B:

Lineage for d4f38b_ (4f38 B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.8: RhoGDI-like [81288] (3 proteins)

6. Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [195317] (1 PDB entry)

8. Domain d4f38b_: 4f38 B: [195318]
   Other proteins in same PDB: d4f38a_
   automated match to d1doab_
   complexed with ger, gnp, mg

Details for d4f38b_

PDB Entry: 4f38, 2.8 Å

PDB Description: Crystal structure of geranylgeranylated RhoA in complex with RhoGDI in its active GPPNHP-bound form

PDB Compounds: (B:) rho GDP-dissociation inhibitor 1

SCOPe Domain Sequences for d4f38b_:

Sequence, based on SEQRES records:

>d4f38b_ b.1.18.8 (B:) Rho GDP-dissociation inhibitor 1, RhoGDI {Mouse (Mus musculus) [TaxId: 10090]}
taeqlaqiaaeneedehsvnykppaqksiqeiqeldkddeslrkykeallgrvavsadpn
vpnvvvtrltlvcstapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsgm
kyiqhtyrkgvkidktdymvgsygpraeeyefltpmeeapkgmlargsyniksrftdddr
tdhlswewnltikkewkd

Sequence, based on observed residues (ATOM records):

>d4f38b_ b.1.18.8 (B:) Rho GDP-dissociation inhibitor 1, RhoGDI {Mouse (Mus musculus) [TaxId: 10090]}
taeqlaqiaaenvnykppaqksiqeiqeldkddeslrkykeallgrvavsadpnvpnvvv
trltlvcstapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsgmkyiqht
yrkgvkidktdymvgsygpraeeyefltpmeeapkgmlargsyniksrftdddrtdhlsw
ewnltikkewkd

Timeline for d4f38b_:

• d4f38b_ first appeared in SCOPe 2.02
  
• d4f38b_ appears in SCOPe 2.04
  
• d4f38b_ appears in SCOPe 2.06
  
• d4f38b_ appears in the current release, SCOPe 2.08