Lineage for d4f3wb_ (4f3w B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2918481Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2918482Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2918813Family c.97.1.0: automated matches [191471] (1 protein)
    not a true family
  6. 2918814Protein automated matches [190746] (16 species)
    not a true protein
  7. 2918857Species Mycobacterium marinum [TaxId:216594] [195312] (1 PDB entry)
  8. 2918859Domain d4f3wb_: 4f3w B: [195314]
    automated match to d3r2nd_
    complexed with zn

Details for d4f3wb_

PDB Entry: 4f3w (more details), 1.8 Å

PDB Description: crystal structure of cytidine deaminase cdd from mycobacterium marinum
PDB Compounds: (B:) Cytidine deaminase Cdd

SCOPe Domain Sequences for d4f3wb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f3wb_ c.97.1.0 (B:) automated matches {Mycobacterium marinum [TaxId: 216594]}
pdidwkqlrdkatqvaagayapysrfpvgaaalvddgrvvtgcnvenvsyglalcaecgv
vcalhatgggrlvalacvdgrgaplmpcgrcrqllfehggpellvdhlagprrlgdllpe
p

SCOPe Domain Coordinates for d4f3wb_:

Click to download the PDB-style file with coordinates for d4f3wb_.
(The format of our PDB-style files is described here.)

Timeline for d4f3wb_: