Lineage for d3s69a_ (3s69 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2064431Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2066146Protein automated matches [190044] (14 species)
    not a true protein
  7. 2066180Species Gloydius saxatilis [TaxId:92067] [195310] (1 PDB entry)
  8. 2066181Domain d3s69a_: 3s69 A: [195311]
    automated match to d1op2a_
    complexed with ca

Details for d3s69a_

PDB Entry: 3s69 (more details), 1.43 Å

PDB Description: Crystal structure of saxthrombin
PDB Compounds: (A:) Thrombin-like enzyme defibrase

SCOPe Domain Sequences for d3s69a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s69a_ b.47.1.2 (A:) automated matches {Gloydius saxatilis [TaxId: 92067]}
viggdecninehrslvaffnstgffcsgtlineewvltaahcdntnfqmklgvhskkvln
edeqtrnpkekficpnkkndevldkdimlikldsrvsnsehivplslpssppsvgsvchi
mgwgsitpikvtypdvpycayinllddavcqagypellteyrtlcagileggkdtcggds
ggplicngqfqgivsfgahpcgqglkpgvytkvfdynhwiqsiiagnttvtcpq

SCOPe Domain Coordinates for d3s69a_:

Click to download the PDB-style file with coordinates for d3s69a_.
(The format of our PDB-style files is described here.)

Timeline for d3s69a_: