Class b: All beta proteins [48724] (177 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein automated matches [190044] (14 species) not a true protein |
Species Gloydius saxatilis [TaxId:92067] [195310] (1 PDB entry) |
Domain d3s69a_: 3s69 A: [195311] automated match to d1op2a_ complexed with ca |
PDB Entry: 3s69 (more details), 1.43 Å
SCOPe Domain Sequences for d3s69a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s69a_ b.47.1.2 (A:) automated matches {Gloydius saxatilis [TaxId: 92067]} viggdecninehrslvaffnstgffcsgtlineewvltaahcdntnfqmklgvhskkvln edeqtrnpkekficpnkkndevldkdimlikldsrvsnsehivplslpssppsvgsvchi mgwgsitpikvtypdvpycayinllddavcqagypellteyrtlcagileggkdtcggds ggplicngqfqgivsfgahpcgqglkpgvytkvfdynhwiqsiiagnttvtcpq
Timeline for d3s69a_: