Lineage for d3urca_ (3urc A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1127558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1127559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1127560Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)
  6. 1127565Protein alpha-Lytic protease [50498] (1 species)
  7. 1127566Species Lysobacter enzymogenes, 495 [TaxId:69] [50499] (45 PDB entries)
  8. 1127571Domain d3urca_: 3urc A: [195306]
    automated match to d2h5ca_
    complexed with gol, so4; mutant

Details for d3urca_

PDB Entry: 3urc (more details), 1.1 Å

PDB Description: t181g mutant of alpha-lytic protease
PDB Compounds: (A:) alpha-lytic protease

SCOPe Domain Sequences for d3urca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3urca_ b.47.1.1 (A:) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]}
anivggieysinnaslcsvgfsvtrgatkgfvtaghcgtvnatariggavvgtfaarvfp
gndrawvsltsaqtllprvangssfvtvrgsteaavgaavcrsgrttgyqcgtitaknvt
anyaegavrglgqgnacmgrgdsggswitsagqaqgvmsggnvqsngnncgipasqrssl
ferlqpilsqyglslvtg

SCOPe Domain Coordinates for d3urca_:

Click to download the PDB-style file with coordinates for d3urca_.
(The format of our PDB-style files is described here.)

Timeline for d3urca_: