Lineage for d3urda_ (3urd A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1793083Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1793084Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1793085Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)
  6. 1793091Protein alpha-Lytic protease [50498] (1 species)
  7. 1793092Species Lysobacter enzymogenes, 495 [TaxId:69] [50499] (45 PDB entries)
  8. 1793096Domain d3urda_: 3urd A: [195305]
    automated match to d2h5ca_
    complexed with gol, so4; mutant

Details for d3urda_

PDB Entry: 3urd (more details), 1.08 Å

PDB Description: t181a mutant of alpha-lytic protease
PDB Compounds: (A:) alpha-lytic protease

SCOPe Domain Sequences for d3urda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3urda_ b.47.1.1 (A:) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]}
anivggieysinnaslcsvgfsvtrgatkgfvtaghcgtvnatariggavvgtfaarvfp
gndrawvsltsaqtllprvangssfvtvrgsteaavgaavcrsgrttgyqcgtitaknvt
anyaegavrglaqgnacmgrgdsggswitsagqaqgvmsggnvqsngnncgipasqrssl
ferlqpilsqyglslvtg

SCOPe Domain Coordinates for d3urda_:

Click to download the PDB-style file with coordinates for d3urda_.
(The format of our PDB-style files is described here.)

Timeline for d3urda_: