Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
Protein automated matches [190085] (59 species) not a true protein |
Species Alcaligenes faecalis [TaxId:511] [188427] (11 PDB entries) |
Domain d2yz7f_: 2yz7 F: [195296] automated match to d2yz7d_ complexed with ca, cl |
PDB Entry: 2yz7 (more details), 2.19 Å
SCOPe Domain Sequences for d2yz7f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yz7f_ c.2.1.2 (F:) automated matches {Alcaligenes faecalis [TaxId: 511]} mlkgkkavvtgstsgiglamatelakagadvvingfgqpediererstleskfgvkayyl nadlsdaqatrdfiakaaealggldilvnnagiqhtapieefpvdkwnaiialnlsavfh gtaaalpimqkqgwgriiniasahglvasvnksayvaakhgvvgltkvtalenagkgitc naicpgwvrtplvekqieaisqqkgidieaaarellaekqpslqfvtpeqlggaavflss aaadqmtgttlsldggwtar
Timeline for d2yz7f_: