Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins) |
Protein automated matches [190058] (11 species) not a true protein |
Species Betula pendula [TaxId:3505] [195294] (4 PDB entries) |
Domain d4a8va_: 4a8v A: [195295] automated match to d1b6fa_ complexed with 2an, mpd, so4, trs |
PDB Entry: 4a8v (more details), 1.23 Å
SCOPe Domain Sequences for d4a8va_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a8va_ d.129.3.1 (A:) automated matches {Betula pendula [TaxId: 3505]} gvfnyeteatsvipaarlfkafildgdnlfpkvapqaissveniegnggpgtikkisfpe gfpfkyvkdrvdevdhtnfkysysvieggpvgdtlekisneikivatpnggsilkinnky htkgdhevkaeqikaskemgetllravesyllahsdayn
Timeline for d4a8va_: