Lineage for d4a8va_ (4a8v A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2975504Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2975505Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins)
  6. 2975569Protein automated matches [190058] (11 species)
    not a true protein
  7. 2975572Species Betula pendula [TaxId:3505] [195294] (4 PDB entries)
  8. 2975574Domain d4a8va_: 4a8v A: [195295]
    automated match to d1b6fa_
    complexed with 2an, mpd, so4, trs

Details for d4a8va_

PDB Entry: 4a8v (more details), 1.23 Å

PDB Description: Crystal Structure of Birch Pollen Allergen Bet v 1 isoform j in complex with 8-Anilinonaphthalene-1-sulfonate (ANS)
PDB Compounds: (A:) major pollen allergen bet v 1-j

SCOPe Domain Sequences for d4a8va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a8va_ d.129.3.1 (A:) automated matches {Betula pendula [TaxId: 3505]}
gvfnyeteatsvipaarlfkafildgdnlfpkvapqaissveniegnggpgtikkisfpe
gfpfkyvkdrvdevdhtnfkysysvieggpvgdtlekisneikivatpnggsilkinnky
htkgdhevkaeqikaskemgetllravesyllahsdayn

SCOPe Domain Coordinates for d4a8va_:

Click to download the PDB-style file with coordinates for d4a8va_.
(The format of our PDB-style files is described here.)

Timeline for d4a8va_: