Lineage for d4d97a_ (4d97 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1874686Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 1874687Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 1874993Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 1874994Protein automated matches [190215] (23 species)
    not a true protein
  7. 1875075Species Salmonella typhimurium [TaxId:90371] [187759] (13 PDB entries)
  8. 1875084Domain d4d97a_: 4d97 A: [195292]
    automated match to d1j0aa_
    complexed with ben, dsn

Details for d4d97a_

PDB Entry: 4d97 (more details), 1.77 Å

PDB Description: salmonella typhimurium d-cysteine desulfhydrase with d-ser bound at active site
PDB Compounds: (A:) D-Cysteine desulfhydrase

SCOPe Domain Sequences for d4d97a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d97a_ c.79.1.0 (A:) automated matches {Salmonella typhimurium [TaxId: 90371]}
mplhhltrfprlefigaptpleylprlsdylgreiyikrddvtpiamggnklrkleflva
dalregadtlitagaiqsnhvrqtaavaaklglhcvallenpigttaenyltngnrllld
lfntqiemcdaltdpdaqlqtlatrieaqgfrpyvipvggssalgamgyvesaleiaqqc
eevvglssvvvasgsagthaglavglehlmpdveligvtvsrsvaeqkpkvialqqaiag
qlaltatadihlwddyfapgygvpndagmeavkllaslegvlldpvytgkamaglidgis
qkrfnddgpilfihtggapalfayhphv

SCOPe Domain Coordinates for d4d97a_:

Click to download the PDB-style file with coordinates for d4d97a_.
(The format of our PDB-style files is described here.)

Timeline for d4d97a_: