Lineage for d1jiab_ (1jia B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6695Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
  4. 6696Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (2 families) (S)
  5. 6701Family a.133.1.2: Vertebrate phospholipase A2 [48623] (4 proteins)
  6. 6765Protein Snake phospholipase A2 [48624] (12 species)
  7. 6769Species Chinese water moccasin (Agkistrodon halys pallas), different isoforms [48628] (6 PDB entries)
  8. 6773Domain d1jiab_: 1jia B: [19529]

Details for d1jiab_

PDB Entry: 1jia (more details), 2.13 Å

PDB Description: structure of a basic phospholipase a2 from agkistrodon halys pallas at 2.13a resolution

SCOP Domain Sequences for d1jiab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jiab_ a.133.1.2 (B:) Snake phospholipase A2 {Chinese water moccasin (Agkistrodon halys pallas), different isoforms}
hllqfrkmikkmtgkepvvsyafygcycgsggrgkpkdatdrccfvhdccyekvtgcdpk
wddytyswkngtivcggddpckkevcecdkaaaicfrdnlktykkrymaypdilcsskse
kc

SCOP Domain Coordinates for d1jiab_:

Click to download the PDB-style file with coordinates for d1jiab_.
(The format of our PDB-style files is described here.)

Timeline for d1jiab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jiaa_