Lineage for d1jiab_ (1jia B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338840Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2338841Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2338846Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2338958Protein Snake phospholipase A2 [48624] (38 species)
  7. 2339014Species Halys viper (Agkistrodon halys) [TaxId:8714] [48628] (9 PDB entries)
  8. 2339020Domain d1jiab_: 1jia B: [19529]
    complexed with ca

Details for d1jiab_

PDB Entry: 1jia (more details), 2.13 Å

PDB Description: structure of a basic phospholipase a2 from agkistrodon halys pallas at 2.13a resolution
PDB Compounds: (B:) phospholipase a2

SCOPe Domain Sequences for d1jiab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jiab_ a.133.1.2 (B:) Snake phospholipase A2 {Halys viper (Agkistrodon halys) [TaxId: 8714]}
hllqfrkmikkmtgkepvvsyafygcycgsggrgkpkdatdrccfvhdccyekvtgcdpk
wddytyswkngtivcggddpckkevcecdkaaaicfrdnlktykkrymaypdilcsskse
kc

SCOPe Domain Coordinates for d1jiab_:

Click to download the PDB-style file with coordinates for d1jiab_.
(The format of our PDB-style files is described here.)

Timeline for d1jiab_: