Lineage for d3crnb_ (3crn B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1837703Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1838070Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 1838071Protein automated matches [190131] (59 species)
    not a true protein
  7. 1838207Species Methanospirillum hungatei [TaxId:323259] [188365] (2 PDB entries)
  8. 1838209Domain d3crnb_: 3crn B: [195284]
    automated match to d2zwma_
    complexed with gol, na

Details for d3crnb_

PDB Entry: 3crn (more details), 1.58 Å

PDB Description: crystal structure of response regulator receiver domain protein (chey- like) from methanospirillum hungatei jf-1
PDB Compounds: (B:) Response regulator receiver domain protein, CheY-like

SCOPe Domain Sequences for d3crnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3crnb_ c.23.1.0 (B:) automated matches {Methanospirillum hungatei [TaxId: 323259]}
slkrilivdddtaildstkqilefegyeveiaatageglakieneffnlalfdiklpdme
gtellekahklrpgmkkimvtgyaslensvfslnagadayimkpvnprdllekikeklde
qekeg

SCOPe Domain Coordinates for d3crnb_:

Click to download the PDB-style file with coordinates for d3crnb_.
(The format of our PDB-style files is described here.)

Timeline for d3crnb_: