| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
| Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
| Protein automated matches [190131] (59 species) not a true protein |
| Species Methanospirillum hungatei [TaxId:323259] [188365] (2 PDB entries) |
| Domain d3crnb_: 3crn B: [195284] automated match to d2zwma_ complexed with gol, na |
PDB Entry: 3crn (more details), 1.58 Å
SCOPe Domain Sequences for d3crnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3crnb_ c.23.1.0 (B:) automated matches {Methanospirillum hungatei [TaxId: 323259]}
slkrilivdddtaildstkqilefegyeveiaatageglakieneffnlalfdiklpdme
gtellekahklrpgmkkimvtgyaslensvfslnagadayimkpvnprdllekikeklde
qekeg
Timeline for d3crnb_: