Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.167: Peptide deformylase [56419] (1 superfamily) alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix |
Superfamily d.167.1: Peptide deformylase [56420] (2 families) nickel-dependent enzyme |
Family d.167.1.1: Peptide deformylase [56421] (2 proteins) automatically mapped to Pfam PF01327 |
Protein Peptide deformylase [56422] (11 species) |
Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [90057] (10 PDB entries) |
Domain d4eoxp_: 4eox P: [195281] automated match to d1lm6a_ complexed with 0s5, ni |
PDB Entry: 4eox (more details), 1.78 Å
SCOPe Domain Sequences for d4eoxp_:
Sequence, based on SEQRES records: (download)
>d4eoxp_ d.167.1.1 (P:) Peptide deformylase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} saieritkaahlidmndiiregnptlrtvaeevtfplsdqeiilgekmmqflkhsqdpvm aekmglrggvglaapqldiskriiavlvpniveegetpqeaydleaimynpkivshsvqd aalgegegclsvdrnvpgyvvrharvtvdyfdkdgekhriklkgynsivvqheidhingi mfydrinekdpfavkdgllil
>d4eoxp_ d.167.1.1 (P:) Peptide deformylase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} saieritkaahlidmndiiregnptlrtvaeevtfplsdqeiilgekmmqflkhsqdpvm aekmglrggvglaapqldiskriiavlvpniaydleaimynpkivshsvqdaalgegegc lsvdrnvpgyvvrharvtvdyfdkdgekhriklkgynsivvqheidhingimfydrinek dpfavkdgllil
Timeline for d4eoxp_: