Lineage for d4eoxp_ (4eox P:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3000942Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 3000943Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. 3000944Family d.167.1.1: Peptide deformylase [56421] (2 proteins)
    automatically mapped to Pfam PF01327
  6. 3000945Protein Peptide deformylase [56422] (11 species)
  7. 3001031Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [90057] (10 PDB entries)
  8. 3001033Domain d4eoxp_: 4eox P: [195281]
    automated match to d1lm6a_
    complexed with 0s5, ni

Details for d4eoxp_

PDB Entry: 4eox (more details), 1.78 Å

PDB Description: X-ray Structure of Polypeptide Deformylase Bound to a Acylprolinamide inhibitor
PDB Compounds: (P:) Peptide deformylase

SCOPe Domain Sequences for d4eoxp_:

Sequence, based on SEQRES records: (download)

>d4eoxp_ d.167.1.1 (P:) Peptide deformylase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
saieritkaahlidmndiiregnptlrtvaeevtfplsdqeiilgekmmqflkhsqdpvm
aekmglrggvglaapqldiskriiavlvpniveegetpqeaydleaimynpkivshsvqd
aalgegegclsvdrnvpgyvvrharvtvdyfdkdgekhriklkgynsivvqheidhingi
mfydrinekdpfavkdgllil

Sequence, based on observed residues (ATOM records): (download)

>d4eoxp_ d.167.1.1 (P:) Peptide deformylase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
saieritkaahlidmndiiregnptlrtvaeevtfplsdqeiilgekmmqflkhsqdpvm
aekmglrggvglaapqldiskriiavlvpniaydleaimynpkivshsvqdaalgegegc
lsvdrnvpgyvvrharvtvdyfdkdgekhriklkgynsivvqheidhingimfydrinek
dpfavkdgllil

SCOPe Domain Coordinates for d4eoxp_:

Click to download the PDB-style file with coordinates for d4eoxp_.
(The format of our PDB-style files is described here.)

Timeline for d4eoxp_: