Lineage for d4f3ga_ (4f3g A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2520988Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2522032Protein automated matches [190140] (38 species)
    not a true protein
  7. 2522215Species Norway rat (Rattus norvegicus) [TaxId:10116] [189278] (36 PDB entries)
  8. 2522259Domain d4f3ga_: 4f3g A: [195278]
    automated match to d3lswa_
    complexed with kai, zn

Details for d4f3ga_

PDB Entry: 4f3g (more details), 2.06 Å

PDB Description: kainate bound to the ligand binding domain of glua3i
PDB Compounds: (A:) Glutamate receptor 3

SCOPe Domain Sequences for d4f3ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f3ga_ c.94.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rtivvttilespyvmykknheqlegneryegycvdlayeiakhvrikyklsivgdgkyga
rdpetkiwngmvgelvygradiavapltitlvreevidfskpfmslgisimikkgtpies
aedlakqteiaygtldsgstkeffrrskiavyekmwsymksaepsvftkttadgvarvrk
skgkfafllestmneyieqrkpcdtmkvggnldskgygvatpkgsalgtpvnlavlklse
qgildklknkwwydkgec

SCOPe Domain Coordinates for d4f3ga_:

Click to download the PDB-style file with coordinates for d4f3ga_.
(The format of our PDB-style files is described here.)

Timeline for d4f3ga_: