Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins) |
Protein automated matches [190140] (9 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [189278] (22 PDB entries) |
Domain d4f3ba_: 4f3b A: [195276] automated match to d3m3ka_ complexed with glu, zn; mutant |
PDB Entry: 4f3b (more details), 1.82 Å
SCOPe Domain Sequences for d4f3ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f3ba_ c.94.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} rtivvttilespyvmykknheqlegneryegycvdlayeiakhvrikyklsivgdgkyga rdpetkiwngmvgelvygradiavapltitlvreevidfskpfmslgisimikkgtpies aedlakqteiaygtlasgstkeffrrskiavyekmwsymksaepsvftkttadgvarvrk skgkfafllestmneyieqrkpcdtmkvggnldskgygvatpkgsalgnavnlavlklne qglldklknkwwydkgec
Timeline for d4f3ba_: