Lineage for d4f31b_ (4f31 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2914680Protein automated matches [190140] (37 species)
    not a true protein
  7. 2914848Species Norway rat (Rattus norvegicus) [TaxId:10116] [189278] (36 PDB entries)
  8. 2914900Domain d4f31b_: 4f31 B: [195272]
    automated match to d3m3ka_
    complexed with kai, zn; mutant

Details for d4f31b_

PDB Entry: 4f31 (more details), 2.29 Å

PDB Description: kainate bound to the d655a mutant of the ligand binding domain of glua3
PDB Compounds: (B:) Glutamate receptor 3

SCOPe Domain Sequences for d4f31b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f31b_ c.94.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rtivvttilespyvmykknheqlegneryegycvdlayeiakhvrikyklsivgdgkyga
rdpetkiwngmvgelvygradiavapltitlvreevidfskpfmslgisimikkgtpies
aedlakqteiaygtlasgstkeffrrskiavyekmwsymksaepsvftkttadgvarvrk
skgkfafllestmneyieqrkpcdtmkvggnldskgygvatpkgsalgnavnlavlklne
qglldklknkwwydkgec

SCOPe Domain Coordinates for d4f31b_:

Click to download the PDB-style file with coordinates for d4f31b_.
(The format of our PDB-style files is described here.)

Timeline for d4f31b_: