SCOPe 2.08: Domain d4f31b_: 4f31 B:

Lineage for d4f31b_ (4f31 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein automated matches [190140] (37 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [189278] (36 PDB entries)

8. Domain d4f31b_: 4f31 B: [195272]
   automated match to d3m3ka_
   complexed with kai, zn; mutant

Details for d4f31b_

PDB Entry: 4f31, 2.29 Å

PDB Description: kainate bound to the d655a mutant of the ligand binding domain of glua3

PDB Compounds: (B:) Glutamate receptor 3

SCOPe Domain Sequences for d4f31b_:

Sequence; same for both SEQRES and ATOM records:

>d4f31b_ c.94.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rtivvttilespyvmykknheqlegneryegycvdlayeiakhvrikyklsivgdgkyga
rdpetkiwngmvgelvygradiavapltitlvreevidfskpfmslgisimikkgtpies
aedlakqteiaygtlasgstkeffrrskiavyekmwsymksaepsvftkttadgvarvrk
skgkfafllestmneyieqrkpcdtmkvggnldskgygvatpkgsalgnavnlavlklne
qglldklknkwwydkgec

Timeline for d4f31b_:

• d4f31b_ first appeared in SCOPe 2.02
  
• d4f31b_ appears in SCOPe 2.07