Lineage for d4f6da_ (4f6d A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1074917Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1074918Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1077267Family a.1.1.4: Nerve tissue mini-hemoglobin (neural globin) [74660] (2 proteins)
    lack the first helix but otherwise is more similar to conventional globins than the truncated ones
  6. 1077268Protein Nerve tissue mini-hemoglobin (neural globin) [74661] (1 species)
  7. 1077269Species Milky ribbon worm (Cerebratulus lacteus) [TaxId:6221] [74662] (11 PDB entries)
    Uniprot O76242
  8. 1077278Domain d4f6da_: 4f6d A: [195271]
    automated match to d2xkia_
    complexed with hem, oxy

Details for d4f6da_

PDB Entry: 4f6d (more details), 1.8 Å

PDB Description: Oxy structure of His100Phe Cerebratulus lacteus mini-hemoglobin
PDB Compounds: (A:) neural hemoglobin

SCOPe Domain Sequences for d4f6da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f6da_ a.1.1.4 (A:) Nerve tissue mini-hemoglobin (neural globin) {Milky ribbon worm (Cerebratulus lacteus) [TaxId: 6221]}
mvnwaavvddfyqelfkahpeyqnkfgfkgvalgslkgnaayktqagktvdyinaaiggs
adaaglasrhkgrnvgsaefhnakaclakacsahgapdlgfaiddilshl

SCOPe Domain Coordinates for d4f6da_:

Click to download the PDB-style file with coordinates for d4f6da_.
(The format of our PDB-style files is described here.)

Timeline for d4f6da_: