Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.4: Nerve tissue mini-hemoglobin (neural globin) [74660] (2 proteins) lack the first helix but otherwise is more similar to conventional globins than the truncated ones |
Protein Nerve tissue mini-hemoglobin (neural globin) [74661] (1 species) |
Species Milky ribbon worm (Cerebratulus lacteus) [TaxId:6221] [74662] (11 PDB entries) Uniprot O76242 |
Domain d4f6da_: 4f6d A: [195271] automated match to d2xkia_ complexed with hem, oxy |
PDB Entry: 4f6d (more details), 1.8 Å
SCOPe Domain Sequences for d4f6da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f6da_ a.1.1.4 (A:) Nerve tissue mini-hemoglobin (neural globin) {Milky ribbon worm (Cerebratulus lacteus) [TaxId: 6221]} mvnwaavvddfyqelfkahpeyqnkfgfkgvalgslkgnaayktqagktvdyinaaiggs adaaglasrhkgrnvgsaefhnakaclakacsahgapdlgfaiddilshl
Timeline for d4f6da_: