![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.4: Nerve tissue mini-hemoglobin (neural globin) [74660] (2 proteins) lack the first helix but otherwise is more similar to conventional globins than the truncated ones automatically mapped to Pfam PF00042 |
![]() | Protein automated matches [191208] (1 species) not a true protein |
![]() | Species Milky ribbon worm (Cerebratulus lacteus) [TaxId:6221] [189562] (4 PDB entries) |
![]() | Domain d4f69a_: 4f69 A: [195270] automated match to d2vyya_ complexed with cmo, gol, hem |
PDB Entry: 4f69 (more details), 1.6 Å
SCOPe Domain Sequences for d4f69a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f69a_ a.1.1.4 (A:) automated matches {Milky ribbon worm (Cerebratulus lacteus) [TaxId: 6221]} mvnwaavvddffqelfkahpeyqnkfgfkgvalgslkgnaayktlagkvvdyinawiggs adaaglasrhkgrnvgsaefhnakaclakacsahgapdlghaiddilshl
Timeline for d4f69a_: