Lineage for d1bk9__ (1bk9 -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (2 families) 
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (4 proteins) Protein Snake phospholipase A2 [48624] (12 species) 
Species Chinese water moccasin (Agkistrodon halys pallas), different isoforms [48628] (6 PDB entries) 
Domain d1bk9__: 1bk9 - [19527]
Details for d1bk9__
PDB Entry: 1bk9 (more details), 2 Å
PDB Description: phospholipase a2 modified by pbpb
SCOP Domain Sequences for d1bk9__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bk9__ a.133.1.2 (-) Snake phospholipase A2 {Chinese water moccasin (Agkistrodon halys pallas), different isoforms}
sliqfetlimkvakksgmfwysnygcycgwggqgrpqdatdrccfvhdccygkvtgcdpk
mdvysfseengdivcggddpckkeicecdraaaicfrdnltlyndkkywafgakncpqee
sepc
SCOP Domain Coordinates for d1bk9__:
Click to download the PDB-style file with coordinates for d1bk9__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bk9__:
- d1bk9__ appears in SCOP 1.57
- d1bk9__ appears in the current release, SCOPe 2.08, called d1bk9a_
View in 3D