Lineage for d4f68a_ (4f68 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2689373Family a.1.1.4: Nerve tissue mini-hemoglobin (neural globin) [74660] (2 proteins)
    lack the first helix but otherwise is more similar to conventional globins than the truncated ones
    automatically mapped to Pfam PF00042
  6. 2689389Protein automated matches [191208] (1 species)
    not a true protein
  7. 2689390Species Milky ribbon worm (Cerebratulus lacteus) [TaxId:6221] [189562] (4 PDB entries)
  8. 2689392Domain d4f68a_: 4f68 A: [195269]
    automated match to d2vyya_
    complexed with hem, oxy

Details for d4f68a_

PDB Entry: 4f68 (more details), 1.8 Å

PDB Description: Oxy structure of Tyr11Phe/Gln44Leu/Thr48Val/Ala55Trp Cerebratulus lacteus mini-hemoglobin
PDB Compounds: (A:) neural hemoglobin

SCOPe Domain Sequences for d4f68a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f68a_ a.1.1.4 (A:) automated matches {Milky ribbon worm (Cerebratulus lacteus) [TaxId: 6221]}
mvnwaavvddffqelfkahpeyqnkfgfkgvalgslkgnaayktlagkvvdyinawiggs
adaaglasrhkgrnvgsaefhnakaclakacsahgapdlghaiddilshl

SCOPe Domain Coordinates for d4f68a_:

Click to download the PDB-style file with coordinates for d4f68a_.
(The format of our PDB-style files is described here.)

Timeline for d4f68a_: