Lineage for d4f6ja_ (4f6j A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2689373Family a.1.1.4: Nerve tissue mini-hemoglobin (neural globin) [74660] (2 proteins)
    lack the first helix but otherwise is more similar to conventional globins than the truncated ones
    automatically mapped to Pfam PF00042
  6. 2689374Protein Nerve tissue mini-hemoglobin (neural globin) [74661] (1 species)
  7. 2689375Species Milky ribbon worm (Cerebratulus lacteus) [TaxId:6221] [74662] (13 PDB entries)
    Uniprot O76242
  8. 2689383Domain d4f6ja_: 4f6j A: [195268]
    automated match to d2xkia_
    complexed with cmo, hem

Details for d4f6ja_

PDB Entry: 4f6j (more details), 1.45 Å

PDB Description: carbonmonoxy structure of his100trp cerebratulus lacteus mini- hemoglobin
PDB Compounds: (A:) neural hemoglobin

SCOPe Domain Sequences for d4f6ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f6ja_ a.1.1.4 (A:) Nerve tissue mini-hemoglobin (neural globin) {Milky ribbon worm (Cerebratulus lacteus) [TaxId: 6221]}
mvnwaavvddfyqelfkahpeyqnkfgfkgvalgslkgnaayktqagktvdyinaaiggs
adaaglasrhkgrnvgsaefhnakaclakacsahgapdlgwaiddilshl

SCOPe Domain Coordinates for d4f6ja_:

Click to download the PDB-style file with coordinates for d4f6ja_.
(The format of our PDB-style files is described here.)

Timeline for d4f6ja_: