SCOPe 2.05: Domain d3sjqd_: 3sjq D:

Lineage for d3sjqd_ (3sjq D:)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.15: Small-conductance potassium channel [81328] (1 superfamily)
   oligomeric transmembrane alpha-helical protein

4. Superfamily f.15.1: Small-conductance potassium channel [81327] (1 family)

5. Family f.15.1.1: Small-conductance potassium channel [81326] (1 protein)

6. Protein Small-conductance potassium channel [64528] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [64529] (8 PDB entries)

8. Domain d3sjqd_: 3sjq D: [195262]
   Other proteins in same PDB: d3sjqa_, d3sjqb_
   automated match to d1g4yb_
   complexed with ca, gol, phu, so4

Details for d3sjqd_

PDB Entry: 3sjq, 1.9 Å

PDB Description: Crystal structure of a small conductance potassium channel splice variant complexed with calcium-calmodulin

PDB Compounds: (D:) Small conductance calcium-activated potassium channel protein 2

SCOPe Domain Sequences for d3sjqd_:

Sequence; same for both SEQRES and ATOM records:

>d3sjqd_ f.15.1.1 (D:) Small-conductance potassium channel {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qltkrvknaaanvlretwliykntklvkkidhakvrkhqrkflqaihqarklrsvkmeqr
klndqantlvdlaktqle

Timeline for d3sjqd_:

• d3sjqd_ first appeared in SCOPe 2.02
  
• d3sjqd_ appears in SCOPe 2.04
  
• d3sjqd_ is called d3sjqd1 in SCOPe 2.06
  
• d3sjqd_ appears in the current release, SCOPe 2.08, called d3sjqd1