![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
![]() | Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) ![]() |
![]() | Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins) |
![]() | Protein Snake phospholipase A2 [48624] (35 species) |
![]() | Species Chinese water moccasin (Agkistrodon halys pallas), different isoforms [48628] (9 PDB entries) |
![]() | Domain d1psj__: 1psj - [19526] complexed with ca |
PDB Entry: 1psj (more details), 2.01 Å
SCOP Domain Sequences for d1psj__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1psj__ a.133.1.2 (-) Snake phospholipase A2 {Chinese water moccasin (Agkistrodon halys pallas), different isoforms} sliqfetlimkvakksgmfwysnygcycgwggqgrpqdatdrccfvhdccygkvtgcdpk mdvysfseengdivcggddpckkeicecdraaaicfrdnltlyndkkywafgakncpqee sepc
Timeline for d1psj__: