Lineage for d1pp2l_ (1pp2 L:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (2 families) 
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (4 proteins) Protein Snake phospholipase A2 [48624] (12 species) 
Species Western diamondback rattlesnake (Crotalus atrox) [TaxId:8730] [48627] (1 PDB entry) 
Domain d1pp2l_: 1pp2 L: [19525]
Details for d1pp2l_
PDB Entry: 1pp2 (more details), 2.5 Å
PDB Description: the refined crystal structure of dimeric phospholipase a2 at 2.5 angstroms. access to a shielded catalytic center
SCOP Domain Sequences for d1pp2l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pp2l_ a.133.1.2 (L:) Snake phospholipase A2 {Western diamondback rattlesnake (Crotalus atrox)}
slvqfetlimkiagrsgllwysaygcycgwgghglpqdatdrccfvhdccygkatdcnpk
tvsytyseengeiicggddpcgtqicecdkaaaicfrdnipsydnkywlfppkdcreepe
pc
SCOP Domain Coordinates for d1pp2l_:
Click to download the PDB-style file with coordinates for d1pp2l_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pp2l_:
- d1pp2l_ appears in SCOP 1.57
- d1pp2l_ appears in the current release, SCOPe 2.08
View in 3D
